PSMC3 Antibody - N-terminal region : Biotin

PSMC3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58176_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PSMC3 is a subunit of the 26S proteasome. 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 6A

Protein Size: 439

Purification: Affinity Purified

Subunit: 6A
Mehr Informationen
Artikelnummer AVIARP58176_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58176_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5702
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×