PSMD3 Antibody - N-terminal region : Biotin

PSMD3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56479_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 3

Protein Size: 534

Purification: Affinity Purified

Subunit: 3
Mehr Informationen
Artikelnummer AVIARP56479_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56479_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5709
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×