PSMF1 Antibody - N-terminal region : FITC

PSMF1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59166_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: Auf Bestellung
575,00 €
Versandbereit ab Lager Wien in ca. 14 Tagen.
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PSMF1

Key Reference: N/A

Molecular Weight: 29 kDa

Peptide Sequence: Synthetic peptide located within the following region: FGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 271

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP59166_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59166_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9491
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×