PTX3 Antibody - N-terminal region : Biotin

PTX3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56497_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PTX3 plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTX3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pentraxin-related protein PTX3

Protein Size: 381

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56497_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56497_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5806
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×