PYCR1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1

Key Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial

Protein Size: 316

Purification: Affinity Purified

• Artikelnummer: AVIARP57750_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57750_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5831
• Wirt: Rabbit