PYCR2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrroline-5-carboxylate reductase 2

Protein Size: 320

Purification: Affinity Purified

• Artikelnummer: AVIARP54938_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54938_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29920
• Wirt: Rabbit