RAB15 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB15

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-15

Protein Size: 208

Purification: Affinity Purified

• Artikelnummer: AVIARP55918_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55918_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 376267
• Wirt: Rabbit