Rab17 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rab17 might be involved in transcellular transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rab17

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-17

Protein Size: 214

Purification: Affinity Purified

• Artikelnummer: AVIARP57631_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57631_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 19329
• Wirt: Rabbit