RAB23 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB23

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-23

Protein Size: 237

Purification: Affinity Purified

• Artikelnummer: AVIARP56870_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56870_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51715
• Wirt: Rabbit