Rab27a Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Rab27a plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for both granule maturation and granule docking and priming at the immunologic synapse.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified

• Artikelnummer: AVIARP56564_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56564_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11891
• Wirt: Rabbit