Rab27b Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rab27b may be involved in targeting uroplakins to urothelial apical membranes.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-27B

Protein Size: 218

Purification: Affinity Purified

• Artikelnummer: AVIARP56565_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56565_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 80718
• Wirt: Rabbit