RAB39 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RAB39 may be involved in vesicular trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB39

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-39A

Protein Size: 217

Purification: Affinity Purified

• Artikelnummer: AVIARP56965_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56965_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54734
• Wirt: Rabbit