RAB5A Antibody - middle region : FITC

RAB5A Antibody - middle region : FITC
Artikelnummer
AVIARP56563_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB5A is required for the fusion of plasma membranes and early endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB5A

Key Reference: Coyne,C.B., (2007) Cell Host Microbe 2 (3), 181-192

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5A

Protein Size: 215

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56563_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56563_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5868
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×