RAB5B Antibody - N-terminal region : FITC

RAB5B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56499_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B

Key Reference: Hirota,Y., (2007) Biochem. Biophys. Res. Commun. 364 (1), 40-47

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5B

Protein Size: 215

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56499_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56499_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5869
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×