RAB5C Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB5C

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5C

Protein Size: 216

Purification: Affinity Purified

• Artikelnummer: AVIARP57818_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57818_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5878
• Wirt: Rabbit