English
RAD1 Antibody - middle region : Biotin
RAD1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57717_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD1
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cell cycle checkpoint protein RAD1
Protein Size: 282
Purification: Affinity Purified
Description of Target: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD1
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cell cycle checkpoint protein RAD1
Protein Size: 282
Purification: Affinity Purified
| Artikelnummer | AVIARP57717_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57717_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5810 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
