RAD1 Antibody - middle region : HRP

RAD1 Antibody - middle region : HRP
Artikelnummer
AVIARP57717_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cell cycle checkpoint protein RAD1

Protein Size: 282

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57717_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57717_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5810
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×