RAD51L1 Antibody - middle region : Biotin

RAD51L1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57720_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair protein RAD51 homolog 2

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57720_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57720_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5890
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×