RALGPS2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human RALGPS2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS2

Protein Size: 279

Purification: Affinity Purified

• Artikelnummer: AVIARP57091_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57091_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55103
• Wirt: Rabbit