RANBP3 Antibody - N-terminal region : Biotin

RANBP3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58520_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP3

Key Reference: Yoon,S.O., (2008) Mol. Cell 29 (3), 362-375

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ran-binding protein 3

Protein Size: 567

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58520_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58520_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8498
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×