RANGAP1 Antibody - N-terminal region : HRP

RANGAP1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56509_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGA

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANGAP1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ran GTPase-activating protein 1

Protein Size: 587

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56509_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56509_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5905
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×