RAP1GAP Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: TWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified

• Artikelnummer: AVIARP56512_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56512_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5909
• Wirt: Rabbit