RASGRF1 Antibody - middle region : FITC

RASGRF1 Antibody - middle region : FITC
Artikelnummer
AVIARP56515_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1

Molecular Weight: 145kDa

Peptide Sequence: Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor 1

Protein Size: 1273

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56515_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56515_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5923
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×