English
RASGRF1 Antibody - N-terminal region : Biotin
RASGRF1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56516_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1
Key Reference: Iguchi,T., (2007) Int. J. Oncol. 31 (2), 285-291
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Ras-specific guanine nucleotide-releasing factor 1
Protein Size: 489
Purification: Affinity Purified
Specificity#: Predicted to recognized both human RASGRF1 isoforms (145, 55kD)
Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1
Key Reference: Iguchi,T., (2007) Int. J. Oncol. 31 (2), 285-291
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Ras-specific guanine nucleotide-releasing factor 1
Protein Size: 489
Purification: Affinity Purified
Specificity#: Predicted to recognized both human RASGRF1 isoforms (145, 55kD)
| Artikelnummer | AVIARP56516_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56516_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5923 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
