RASL12 Antibody - N-terminal region : HRP

RASL12 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56945_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASL12

Key Reference: Pulverer,B.J., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-like protein family member 12

Protein Size: 266

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56945_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56945_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51285
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×