RBJ Antibody - middle region : FITC

RBJ Antibody - middle region : FITC
Artikelnummer
AVIARP56938_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBJ

Key Reference: von (2004) Gene 327 (2), 221-232

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily C member 27

Protein Size: 273

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56938_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56938_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51277
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×