Rcc2 Antibody - N-terminal region : Biotin

Rcc2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57289_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Rcc2 is required for completion of mitosis and cytokinesis. It may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RCC2

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57289_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57289_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 108911
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×