English
RD3 Antibody - N-terminal region : FITC
RD3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55856_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3
Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070
Molecular Weight: 23kDa
Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Protein RD3
Protein Size: 195
Purification: Affinity Purified
Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3
Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070
Molecular Weight: 23kDa
Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Protein RD3
Protein Size: 195
Purification: Affinity Purified
| Artikelnummer | AVIARP55856_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55856_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Dog (Canine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 343035 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
