RD3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RD3

Protein Size: 195

Purification: Affinity Purified

• Artikelnummer: AVIARP55856_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55856_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 343035
• Wirt: Rabbit