Recombinant Human C14orf93 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H972

Gene Name: C14orf93

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Glu241

End Site: Glu390

Coverage: 0.30

Isoelectric Point: 10

Core Sequence: ENGTKLPPPRPEDMLNAAAALDSALEESGPGSTGELRHSLGLTVSPCRTRGSGQKNSRRKRDLVLSKLVHNVHNHITNDKRFNGSESIKSSWNISVVKFLLEKLKQELVTSPHNYTDKELKGACVAYFLTKRREYRNSLNPFKGLKEKEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Uncharacterized protein C14orf93

Protein name: chromosome 14 open reading frame 93

Full length: 538 amino acids

Entry name: CN093_HUMAN

• Artikelnummer: ASBPP-2778-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2778-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 60686