Recombinant Human CCPG1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULG6

Gene Name: CCPG1

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Tyr261

End Site: Lys480

Coverage: 0.30

Isoelectric Point: 7.5

Core Sequence: YLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLLTEAKMLKRELERERLVTTALRGELQQLSGSQLHGKSDSPNVYTEKKEIAILRERLTELERKLTFEQQRSDLWERLYVEAKDQNGKQGTDGKKKGGRGSHRAKNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 87%, Cynomolgus monkey - 97%

Alternative gene names: CCP8; CPR8; KIAA1254

Alternative protein names: Cell cycle progression protein 1; Cell cycle progression restoration protein 8

Protein name: cell cycle progression 1

Full length: 757 amino acids

Entry name: CCPG1_HUMAN

• Artikelnummer: ASBPP-2919-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2919-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 9236