Recombinant Human IFT172 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UG01

Gene Name: IFT172

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ala1161

End Site: Leu1420

Coverage: 0.15

Isoelectric Point: 5

Core Sequence: AEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1179

Alternative protein names: Intraflagellar transport protein 172 homolog

Protein name: intraflagellar transport 172

Full length: 1749 amino acids

Entry name: IF172_HUMAN

• Artikelnummer: ASBPP-2888-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2888-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 26160