Recombinant Human LDB2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43679

Gene Name: LDB2

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu211

End Site: Phe340

Coverage: 0.37

Isoelectric Point: 7

Core Sequence: EPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: CLIM1

Alternative protein names: LIM domain-binding protein 2; LDB-2; Carboxyl-terminal LIM domain-binding protein 1; CLIM-1; LIM domain-binding factor CLIM1

Protein name: LIM domain binding 2

Full length: 373 amino acids

Entry name: LDB2_HUMAN

• Artikelnummer: ASBPP-10348-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10348-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9079