Recombinant Human MED4 Protein

Recombinant Human MED4 Protein
Artikelnummer
ASBPP-2806-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPJ6

Gene Name: MED4

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Lys11

End Site: Lys140

Coverage: 0.53

Isoelectric Point: 6

Core Sequence: KERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: ARC36; DRIP36; VDRIP

Alternative protein names: Mediator of RNA polymerase II transcription subunit 4; Activator-recruited cofactor 36 kDa component; ARC36; Mediator complex subunit 4; TRAP/SMCC/PC2 subunit p36 subunit; Vitamin D3 receptor-interacting protein complex 36 kDa component; DRIP36

Protein name: mediator complex subunit 4

Full length: 270 amino acids

Entry name: MED4_HUMAN
Mehr Informationen
Artikelnummer ASBPP-2806-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-2806-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 29079
Produktinformation (PDF)
×
MSDS (PDF)
×