Recombinant Human NDFIP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV92

Gene Name: NDFIP2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Ala11

End Site: Thr160

Coverage: 0.47

Isoelectric Point: 4.5

Core Sequence: ASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 75%, Cynomolgus monkey - 94%

Alternative gene names: KIAA1165; N4WBP5A

Alternative protein names: NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413

Protein name: Nedd4 family interacting protein 2

Full length: 336 amino acids

Entry name: NFIP2_HUMAN

• Artikelnummer: ASBPP-2832-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2832-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 54602