Recombinant Human NOL7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UMY1

Gene Name: NOL7

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Ala31

End Site: Gly200

Coverage: 0.69

Isoelectric Point: 6

Core Sequence: AEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Pig - 85%, Cynomolgus monkey - 98%

Alternative gene names: C6orf90; NOP27

Alternative protein names: Nucleolar protein 7; Nucleolar protein of 27 kDa

Protein name: nucleolar protein 7

Full length: 257 amino acids

Entry name: NOL7_HUMAN

• Artikelnummer: ASBPP-2934-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2934-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 51406