Recombinant Human NUP188 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5SRE5

Gene Name: NUP188

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Leu1181

End Site: Leu1320

Coverage: 0.08

Isoelectric Point: 5

Core Sequence: LGPLTEILEGVLQADQQLMEKTKAKVFSAFITVLQMKEMKVSDIPQYSQLVLNVCETLQEEVIALFDQTRHSLALGSATEDKDSMETDDCSRSRHRDQRDGVCVLGLHLAKELCEVDEDGDSWLQVTRRLPILPTLLTTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0169

Alternative protein names: Nucleoporin NUP188; hNup188

Protein name: nucleoporin 188

Full length: 1749 amino acids

Entry name: NU188_HUMAN

• Artikelnummer: ASBPP-10340-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10340-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 23511