Recombinant Human PCDH10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2E7

Gene Name: PCDH10

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 41%

Start Site: Gln881

End Site: Lys1030

Coverage: 0.15

Isoelectric Point: 6.5

Core Sequence: QRAELSYLVDRPRRVNSSAFQEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNTRAPYK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 41%, Rat - 45%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1400

Alternative protein names: Protocadherin-10

Protein name: protocadherin 10

Full length: 1040 amino acids

Entry name: PCD10_HUMAN

• Artikelnummer: ASBPP-2870-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2870-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57575