Recombinant Human PCDHB10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UN67

Gene Name: PCDHB10

Expression System: Escherichia coli

Molecular Weight: 36 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Lys41

End Site: Thr340

Coverage: 0.40

Isoelectric Point: 4.5

Core Sequence: KGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRDINDHAPVFQDKETVLKISENTAEGTAFRLERAQDPDGGLNGIQNYTISPNSFFHINISGGDEGMIYPELVLDKALDREEQGELSLTLTALDGGSPSRSGTSTVRIVVLDVNDNAPQFAQALYETQAPENSPIGFLIVKVWAEDVDSGVNAEVSYSFFDASENIRTTFQINPFSGEIFLRELLDYELVNSYKINIQAMDGGGLSARCRVLVEVLDT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 53%, Pig - 82%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Protocadherin beta-10; PCDH-beta-10

Protein name: protocadherin beta 10

Full length: 800 amino acids

Entry name: PCDBA_HUMAN

• Artikelnummer: ASBPP-2935-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2935-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 56126