Recombinant Human RERE Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2R6

Gene Name: RERE

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asp531

End Site: Ala640

Coverage: 0.07

Isoelectric Point: 10.5

Core Sequence: DCRIHFKKYGELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTSPINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 47%

Alternative gene names: ARG; ARP; ATN1L; KIAA0458

Alternative protein names: Arginine-glutamic acid dipeptide repeats protein; Atrophin-1-like protein; Atrophin-1-related protein

Protein name: arginine-glutamic acid dipeptide repeats

Full length: 1566 amino acids

Entry name: RERE_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2877-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2877-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 473