Recombinant Human TMEM51 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NW97

Gene Name: TMEM51

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Gln91

End Site: Arg250

Coverage: 0.66

Isoelectric Point: 5.5

Core Sequence: QRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: C1orf72

Alternative protein names: Transmembrane protein 51

Protein name: transmembrane protein 51

Full length: 253 amino acids

Entry name: TMM51_HUMAN

• Artikelnummer: ASBPP-2838-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2838-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 55092