Recombinant Human ZBTB40 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NUA8

Gene Name: ZBTB40

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asn691

End Site: Gly860

Coverage: 0.14

Isoelectric Point: 8.5

Core Sequence: NNKEDEKAAKEDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKECSETKDSKKELDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 33%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0478

Alternative protein names: Zinc finger and BTB domain-containing protein 40

Protein name: zinc finger and BTB domain containing 40

Full length: 1239 amino acids

Entry name: ZBT40_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2830-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2830-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9923