Recombinant Human ZNF229 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJW7

Gene Name: ZNF229

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Arg11

End Site: Asp130

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: RALHSQASAISQDREEKIMSQEPLSFKDVAVVFTEEELELLDSTQRQLYQDVMQENFRNLLSVGERNPLGDKNGKDTEYIQDEELRFFSHKELSSCKIWEEVAGELPGSQDCRVNLQGKD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 50%, Pig - 55%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 229

Protein name: zinc finger protein 229

Full length: 825 amino acids

Entry name: ZN229_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2903-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2903-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 7772