Recombinant Human ZNF446 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NWS9

Gene Name: ZNF446

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 33%

Start Site: Thr131

End Site: Pro310

Coverage: 0.40

Isoelectric Point: 5

Core Sequence: TEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 33%, Rat - 32%, Pig - 59%, Cynomolgus monkey - 94%

Alternative gene names: ZKSCAN20

Alternative protein names: Zinc finger protein 446; Zinc finger protein with KRAB and SCAN domains 20

Protein name: zinc finger protein 446

Full length: 450 amino acids

Entry name: ZN446_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2841-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2841-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 55663