Recombinant Swine CXCL11 protein(N-His)

Recombinant Swine CXCL11 protein(N-His)
Artikelnummer
ELSPKSS000022-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Abbreviation: CXCL11

Target Synonym: Interferon Inducible T-Cell α Chemokine;I-TAC;B-R1;CXCL11;ITAC;SCYB11;SCYB9B

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: B3GDY9

Background: CXCL11, also known as I-TAC, SCYB9B, H174 and beta -R1, is a non-ELR CXC chemokine. CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-gamma and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T cells, neutrophils or monocytes. The gene encoding CXCL11 has been mapped to chromosome 4.

Sequence: MGVKGMAIVLAVIFCATTIQGFPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
Mehr Informationen
Artikelnummer ELSPKSS000022-5
Hersteller Elabscience Biotechnology
Hersteller Artikelnummer ELA-PKSS000022-5
Verpackungseinheit 5 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download