Recombinant Swine CXCL13 protein(N-His)

Abbreviation: CXCL13

Target Synonym: C-X-C motif chemokine 13;Angie;B cell-attracting chemokine 1;B lymphocyte chemoattractant;CXC chemokine BLC;Small-inducible cytokine B13;BCA1;BLC;SCYB13

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: A0A287A706

Background: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Sequence: MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.

• Artikelnummer: ELSPKSS000023-5
• Hersteller: Elabscience Biotechnology
• Hersteller Artikelnummer: ELA-PKSS000023-5
• Green Labware: Nein
• Verpackungseinheit: 5 µg
• Mengeneinheit: STK