English
Recombinant Swine CXCL9 protein(N-His)
Recombinant Swine CXCL9 protein(N-His)
Artikelnummer
ELSPKSS000021-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Abbreviation: CXCL9
Target Synonym: C-X-C motif chemokine 9;Gamma-interferon-induced monokine;Monokine induced by interferon-gamma;MIG;MuMIG;Protein m119;Small-inducible cytokine B9;Cxcl9;Mig;Scyb9
Target Species: Porcine
Expression Host: E.coli
Fusion Tag: N-His
UNIProt ID: A0A4X1SX95
Background: Chemokine (C-X-C Motif) Ligand 9 (CXCL9) belongs to the intercrine alpha (chemokine CXC) family. It is secreted by interferon stimulated monocytes, macrophages and endothelial cells, which elicits chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumour growth inhibition. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4.
Sequence: MKKSSVALLLGIIFLTLIGVQGTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Endotoxin: Please contact us for more information.
Target Synonym: C-X-C motif chemokine 9;Gamma-interferon-induced monokine;Monokine induced by interferon-gamma;MIG;MuMIG;Protein m119;Small-inducible cytokine B9;Cxcl9;Mig;Scyb9
Target Species: Porcine
Expression Host: E.coli
Fusion Tag: N-His
UNIProt ID: A0A4X1SX95
Background: Chemokine (C-X-C Motif) Ligand 9 (CXCL9) belongs to the intercrine alpha (chemokine CXC) family. It is secreted by interferon stimulated monocytes, macrophages and endothelial cells, which elicits chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumour growth inhibition. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4.
Sequence: MKKSSVALLLGIIFLTLIGVQGTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Endotoxin: Please contact us for more information.
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
