Recombinant Swine IL-15 protein(N-His)(active)

Recombinant Swine IL-15 protein(N-His)(active)
Artikelnummer
ELSPKSS000008-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Abbreviation: IL-15

Target Synonym: IL-T

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q95253

Background: Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15.

Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 5. 5 ng/mL.

Sequence: MRILKPCLRSTCIQCYLCLLLNSHFLTEDGIHVFILGCISAGLPKTEATWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
Mehr Informationen
Artikelnummer ELSPKSS000008-5
Hersteller Elabscience Biotechnology
Hersteller Artikelnummer ELA-PKSS000008-5
Verpackungseinheit 5 µg
Mengeneinheit STK
Methode Cell Culture
Produktinformation (PDF) Download
MSDS (PDF) Download