Recombinant Swine IL-4 protein(N-His)(active)

Abbreviation: IL-4

Target Synonym: BCGF;BCDF;B-cell Stimulating Factor (BSF-1)

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q04745

Background: Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation; survival and gene expression. IL-4 is produced by mast cells; T cells; and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells; characterized by their cytokine-secretion profile that includes secretion of IL-4; IL-5; IL-6; IL-10; and IL-13; which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response.

Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.6 ng/mL.

Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.

• Artikelnummer: ELSPKSS000004-5
• Hersteller: Elabscience Biotechnology
• Hersteller Artikelnummer: ELA-PKSS000004-5
• Green Labware: Nein
• Verpackungseinheit: 5 µg
• Mengeneinheit: STK
• Methode: Cell Culture