Recombinant Swine IL-6 protein(N-His)(active)

Recombinant Swine IL-6 protein(N-His)(active)
Artikelnummer
ELSPKSS000005-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Abbreviation: IL-6

Target Synonym: IFN-β2;B-Cell Differentiation Factor (BCDF);BSF-2;HPGF;HSF;MGI-2

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P26893

Background: Interleukin-6 (IL-6) is a multifunctional α-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. It exerts actions through the its heterodimeric receptor composed of IL-6R that lacks the tyrosine/kinase domain and binds IL-6 with low affinity, and ubiquitously expressed glycoprotein 130 (gp130) that binds the IL-6. IL-6R complex with high affinity and thus transduces signals. IL-6 is also involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.

Activity: Measure by its ability to induce proliferation in T1165. 85. 2.1 cells. The ED50 for this effect is < 1. 5 ng/mL.

Sequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
Mehr Informationen
Artikelnummer ELSPKSS000005-5
Hersteller Elabscience Biotechnology
Hersteller Artikelnummer ELA-PKSS000005-5
Verpackungseinheit 5 µg
Mengeneinheit STK
Methode Cell Culture
Produktinformation (PDF) Download
MSDS (PDF) Download